PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011074552.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family ZF-HD
Protein Properties Length: 257aa    MW: 28253 Da    PI: 8.9661
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011074552.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer99.91.8e-3153107358
     ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                     ++ Y+eClkNhAa++Gg+++DGCgEfmps g+egt +alkCaAC+CHRnFHR+e++
  XP_011074552.1  53 RTIYRECLKNHAANIGGNVTDGCGEFMPS-GDEGTLEALKCAACNCHRNFHRKEHH 107
                     678*************************9.999********************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257745.0E-2152105IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047708.4E-2954106IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.38256105IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015667.0E-3056105IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466891.26E-19180250IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.1E-30185250IPR009057Homeodomain-like
TIGRFAMsTIGR015651.1E-30189245IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MSLSTGEEKG MRTQTSSAAY NHSLLENPIS RQEKTRLLDP DCGGSISRPT NPRTIYRECL  60
KNHAANIGGN VTDGCGEFMP SGDEGTLEAL KCAACNCHRN FHRKEHHGGA AMVHPLHLPP  120
PLPSASLAQH HVRGGLAHWA GSMVQPVKMA FCGGGGGSIG TDSSSEELNF NAFHSHAVAP  180
PPPVQFGNKK RFRTKFTAEQ KEKMMGFAEK LGWRIPREDD TELQRFCAEI GVKRQVFKVW  240
MHNNKTSSKK TPQELQI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A5e-261902471875ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011074552.10.0PREDICTED: zinc-finger homeodomain protein 5-like
SwissprotQ9M9S09e-63ZHD4_ARATH; Zinc-finger homeodomain protein 4
TrEMBLS8C3825e-96S8C382_9LAMI; Uncharacterized protein (Fragment)
STRINGPGSC0003DMT4000095812e-80(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75240.17e-59homeobox protein 33